PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN20112.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 910aa    MW: 101428 Da    PI: 5.6446
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN20112.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.23.8e-29594645152
      RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GIkRWP+Rkik++
  KHN20112.1 594 AEKTITLQVLRQYFAGSLKDAAKNIGVCTTTLKRICRQHGIKRWPSRKIKKV 645
                 589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.450.406.7E-4205298IPR029016GAF domain-like
PROSITE profilePS5151917.837582665IPR003035RWP-RK domain
PfamPF020426.4E-25597645IPR003035RWP-RK domain
SMARTSM006662.9E-22816899IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2404.0E-21816896No hitNo description
SuperFamilySSF542777.61E-22816901No hitNo description
PROSITE profilePS5174525.565816899IPR000270PB1 domain
CDDcd064071.09E-39817898No hitNo description
PfamPF005641.0E-17817898IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 910 aa     Download sequence    Send to blast
MMGDGGVTSS AATMMEAPPP DGTTTTSMDF DYMGELFLDG CWMEASADGS DFLLQSPSFS  60
NTLFDPSFSW PALETNHNES QVAAFGSQQE SHNNNMVSVV AGGDYSQQFQ SETHSVEGAS  120
EGIRRWWFAP THTPTPSPGP GPSIMEKLIR ALMWIKDYNR NKDMLIQIWV PVHKEGRPIL  180
AADDLLFSLE SKSLNLAKYR EISVTYKFSA EESDSKELAW GLPGRVFRDK VPEWTPDVRF  240
FKIDEYPRVD HAQEYDVRGT LAVPIFEQGS KTCLGVIEVV MTTQQINYGP ELESVCKALE  300
AVDLRSSKQL SIQNVKQACN RSYEAALPEI HEVLRSACEM HKLPLAQTWV PCVQQGKEGC  360
RHSEDNYLLC ISPVEHACYV GDPSIRSFHE ACTEHHLLKG EGVAGGAFMT NQPCFSDDIT  420
SLSKKDYPMS HHARLFGLRA AVAIRLRSIY NSTDDFVLEF FLPIDCNDIE EQRKMLTSLS  480
NIIQRVCRSL RVIREKELEE ANLSVNEVIA LADSGFTRDE ICSEPQQKGM VASLDTEEKS  540
RETMGRKFSE PRQQQESPIL KGNLDCVREC STSVEGNLSS PGTSKTGERR RVKAEKTITL  600
QVLRQYFAGS LKDAAKNIGV CTTTLKRICR QHGIKRWPSR KIKKVGHSLQ KLQLVIDSVQ  660
GASGAFQIDS FYSNFPDLAS PNLSGTGFFS TLNQSDNPNS TSTQPEHGSL SPEGASKSPS  720
SSSSQSSISS HSCSSMSELQ QQHTTNIASD KDPATVGEDS ADVVLKLIRN EAKLKSLSQD  780
RAKLLPRSLS QETLGEHPKT QYQLPLLKTS SSKVDSHRVK VTYGDEKTRF RMLKNWVYED  840
LLQEIGRKFN VSDMSKFDVK YLDDDCEWIL LTCDADLEEC IDVCQSSESG TIKLSLQPSS  900
HSVRSSLEFR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003527641.20.0PREDICTED: protein NLP4-like isoform X1
RefseqXP_006581138.10.0PREDICTED: protein NLP4-like isoform X1
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLA0A0B2QK210.0A0A0B2QK21_GLYSO; Protein NLP4
STRINGGLYMA06G02030.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]